Proteintech, 85964-1-RR, Cathepsin D Recombinant monoclonal antibody

Size: 20ul / 100ul The Cathepsin D (85964-1-RR) by Proteintech is a Recombinant antibody targeting Cathepsin D in WB, IF/ICC, ELISA applications with reactivity to mouse samples 85964-1-RR targets Cathepsin D in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Neuro-2a cells, RAW 264.7 cells, NIH/3T3 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CTSD (Cathepsin D) also named CPSD, is a representative aspartic proteinase in lysosomes and is widely distributed in various tissue cells of mammals. The expression level of CTSD varies depending on the tissue, whereas neurons in CNS tissues possess abundant CTSD. CTSD is synthesized as a 52-kDa precursor that is converted into an active ~48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 28-kDa heavy chain and a 14-kDa light chain, in the lysosomes (PMID: 10995834, PMID: 7641679, PMID: 30051532). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2986 Product name: Recombinant Mouse Cathepsin D protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-410 aa of NM_009983.3 Sequence: IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL Predict reactive species Full Name: cathepsin D Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 46 kDa, 28 kDa GenBank Accession Number: NM_009983.3 Gene Symbol: Ctsd Gene ID (NCBI): 13033 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18242 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.