Proteintech, 85973-3-RR, NMDAR1/GRIN1 Recombinant monoclonal antibody

Size: 20ul / 100ul The NMDAR1/GRIN1 (85973-3-RR) by Proteintech is a Recombinant antibody targeting NMDAR1/GRIN1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 85973-3-RR targets NMDAR1/GRIN1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information GRIN1 encodes subunit 1 of the N-methyl-D-aspartate (NMDA) receptor, which is a heteromeric glutamate-gated calcium ion channel essential for synaptic function in the brain (PMID: 25864721, PMID: 25864721). NMDARs play important roles in normal brain development and function, such as synaptic plasticity, neural development, learning and memory (PMID: 20716669). NMDAR dysfunction has been associated with several neurological disorders including Parkinson, Alzheimer and Huntington diseases. Disrupted motor learning and long-term synaptic plasticity in mice lacking NMDAR1 in the striatum (PMID: 17015831). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26093 Product name: Recombinant human NMDAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-120 aa of NM_000832 Sequence: MACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG Predict reactive species Full Name: glutamate receptor, ionotropic, N-methyl D-aspartate 1 Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 116-120 kDa GenBank Accession Number: NM_000832 Gene Symbol: NMDAR1 Gene ID (NCBI): 2902 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q05586 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.