Iright
BRAND / VENDOR: Proteintech

Proteintech, 85982-1-RR, IFI30 Recombinant monoclonal antibody

CATALOG NUMBER: 85982-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IFI30 (85982-1-RR) by Proteintech is a Recombinant antibody targeting IFI30 in WB, ELISA applications with reactivity to human, rat samples 85982-1-RR targets IFI30 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, Daudi cells, HL-60 cells, Raji cells, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information IFI30(interferon, gamma-inducible protein 30) is also named as IP30, GILT, IFI-30, MGC32056, IFI30 and belongs to the GILT family. It can facilitate the processing and presentation to antigen-specific T cells of protein antigens containing disulfide bonds. IFI30 is inducibly up-regulated by IFN-g, as are MHC class II molecules, the associated invariant chain, and HLA-DM, which catalyses peptide loading in MIICs and the 35 kDa species is the IFI30 proform, and the 30-kDa species is the mature form(PMID:10639150). It can exsit as a dimer(PMID:17142755). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2178 Product name: Recombinant human IFI30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC021136 Sequence: CSRHTFAPAAMTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK Predict reactive species Full Name: interferon, gamma-inducible protein 30 Calculated Molecular Weight: 261 aa, 29 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC021136 Gene Symbol: IFI30 Gene ID (NCBI): 10437 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13284 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924