Iright
BRAND / VENDOR: Proteintech

Proteintech, 85995-1-RR, ARF3 Recombinant monoclonal antibody

CATALOG NUMBER: 85995-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ARF3 (85995-1-RR) by Proteintech is a Recombinant antibody targeting ARF3 in WB, ELISA applications with reactivity to human, mouse, rat samples 85995-1-RR targets ARF3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, mouse brain tissue, rat brain tissue, fetal human brain tissue, mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20kda protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF3 is 95% homolouous to ARF1. Its function was not fully understood. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1174 Product name: Recombinant human ARF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC017565 Sequence: MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK Predict reactive species Full Name: ADP-ribosylation factor 3 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC017565 Gene Symbol: ARF3 Gene ID (NCBI): 377 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924