Product Description
Size: 20ul / 100ul
The COPZ1 (86014-1-RR) by Proteintech is a Recombinant antibody targeting COPZ1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, monkey samples
86014-1-RR targets COPZ1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.
Tested Applications
Positive WB detected in: HeLa cells, RAW 264.7 cells, COS-7 cells
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human, mouse, monkey
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag14234 Product name: Recombinant human COPZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-84 aa of BC002849 Sequence: YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSY Predict reactive species
Full Name: coatomer protein complex, subunit zeta 1
Calculated Molecular Weight: 177 aa, 20 kDa
Observed Molecular Weight: 15-20 kDa
GenBank Accession Number: BC002849
Gene Symbol: COPZ1
Gene ID (NCBI): 22818
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P61923
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924