Proteintech, 86014-1-RR, COPZ1 Recombinant monoclonal antibody

Size: 20ul / 100ul The COPZ1 (86014-1-RR) by Proteintech is a Recombinant antibody targeting COPZ1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, monkey samples 86014-1-RR targets COPZ1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: HeLa cells, RAW 264.7 cells, COS-7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14234 Product name: Recombinant human COPZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-84 aa of BC002849 Sequence: YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSY Predict reactive species Full Name: coatomer protein complex, subunit zeta 1 Calculated Molecular Weight: 177 aa, 20 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC002849 Gene Symbol: COPZ1 Gene ID (NCBI): 22818 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.