Proteintech, 86020-2-RR, FA2H Recombinant monoclonal antibody

Size: 20ul / 100ul The FA2H (86020-2-RR) by Proteintech is a Recombinant antibody targeting FA2H in WB, ELISA applications with reactivity to human samples 86020-2-RR targets FA2H in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MKN-45 cells, SGC-7901 cells, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information FA2H(Fatty acid 2-hydroxylase) required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. The deduced 372-amino acid protein has a calculated molecular mass of 42.8 kD .Both mouse and human FA2H have a C-terminal endoplasmic reticulum (ER) retention motif(PMID: 15658937). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7717 Product name: Recombinant human FA2H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC002679 Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGL Predict reactive species Full Name: fatty acid 2-hydroxylase Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC002679 Gene Symbol: FA2H Gene ID (NCBI): 79152 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7L5A8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.