Proteintech, 86035-1-RR, UPF3B Recombinant monoclonal antibody

Size: 20ul / 100ul The UPF3B (86035-1-RR) by Proteintech is a Recombinant antibody targeting UPF3B in WB, ELISA applications with reactivity to human samples 86035-1-RR targets UPF3B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, K-562 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Regulator of nonsense transcripts 3B (UPF3B) is also named as RENT3B, and belongs to the RENT3 family. UPF3B is a core junction protein in the Nonsense-mediated RNA decay (NMD) pathway, involved in the exonuclear transport and quality supervision of mRNA. And UPF3B showed heightened expression in hepatocellular carcinoma (HCC) tissues and was linked with adverse prognosis (PMID: 38889220). UPF3B promotes the dissociation of post-termination ribosomal complexes that lack nascent peptide. UPF3B could promote ribosome recycling, and UPF3B serves as a direct regulator of translation termination (PMID: 29333258). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18568 Product name: Recombinant human UPF3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 288-470 aa of BC121017 Sequence: AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQEHILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEGGEE Predict reactive species Full Name: UPF3 regulator of nonsense transcripts homolog B (yeast) Calculated Molecular Weight: 483 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC121017 Gene Symbol: UPF3B Gene ID (NCBI): 65109 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BZI7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.