Iright
BRAND / VENDOR: Proteintech

Proteintech, 86048-1-RR, IRF2BP1 Recombinant monoclonal antibody

CATALOG NUMBER: 86048-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IRF2BP1 (86048-1-RR) by Proteintech is a Recombinant antibody targeting IRF2BP1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86048-1-RR targets IRF2BP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, HEK-293 cells, Jurkar cells, rat brain tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information IRF2BP1 inhibits IRF2-mediated transcriptional activation by interacting with IRF2. In epidermal growth factor receptor (EGFR) signaling, transient deSUMOylation of IRF2BP1 is essential for the proper expression of immediate early genes such as DUSP1 and ATF3. IRF2BP1 is also involved in the TGF-β signaling pathway by controlling the accumulation of cPML in the cytoplasm, which in turn affects the phosphorylation of Smad2 and the assembly of the Smad2-receptor complex. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4596 Product name: Recombinant human IRF2BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-584 aa of BC038222 Sequence: LALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQLGELLTDGVRSFREPAPAEALPQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSAETPGVPSPIAALKNVAEALGHSPKDPGGGGGPVRAGGASPAASSTAQPPTQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGDKCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP Predict reactive species Full Name: interferon regulatory factor 2 binding protein 1 Calculated Molecular Weight: 584 aa, 62 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC038222 Gene Symbol: IRF2BP1 Gene ID (NCBI): 26145 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IU81 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924