Proteintech, 86051-1-RR, PRIM1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PRIM1 (86051-1-RR) by Proteintech is a Recombinant antibody targeting PRIM1 in WB, ELISA applications with reactivity to human, mouse samples 86051-1-RR targets PRIM1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, Sp2/0 cells, MIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information DNA replication in human cells is initiated by a complex apparatus containing a DNA polymerase-alpha/primase complex. Primase synthesizes oligoribonucleotides that serve as primers for the initiation of DNA synthesis. It plays a role in both the initiation of DNA replication and the synthesis of Okazaki fragments for lagging strand synthesis. PRIM1 is a subunit of this complex. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1124 Product name: Recombinant human PRIM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-420 aa of BC005266 Sequence: CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF Predict reactive species Full Name: primase, DNA, polypeptide 1 (49kDa) Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC005266 Gene Symbol: PRIM1 Gene ID (NCBI): 5557 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49642 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.