Proteintech, 86059-2-RR, LRRC32 Recombinant monoclonal antibody

Size: 20ul / 100ul The LRRC32 (86059-2-RR) by Proteintech is a Recombinant antibody targeting LRRC32 in WB, ELISA applications with reactivity to human samples 86059-2-RR targets LRRC32 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information LRRC32, also known as GARP, is a transmembrane protein of 662 amino acids, the extracellular portion of which contains 20 leucine-rich repeats (PMID: 8180135). LRRC32 is a cell surface receptor on regulatory T-lymphocytes (Treg cells), platelets, hepatic stellate cells and certain cancer cells (PMID: 27054568). It has been demonstrated as a Treg-specific activation marker (PMID: 20137067). LRRC32 is critical for the surface expression of latent TGF-β by binding to the complex and functioning as its cell surface receptor (PMID: 19651619). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23423 Product name: Recombinant human LRRC32 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 477-662 aa of BC070079 Sequence: PGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA Predict reactive species Full Name: leucine rich repeat containing 32 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 72-80 kDa GenBank Accession Number: BC070079 Gene Symbol: LRRC32 Gene ID (NCBI): 2615 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14392 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.