Proteintech, 86060-1-RR, FHL2 Recombinant monoclonal antibody

Size: 20ul / 100ul The FHL2 (86060-1-RR) by Proteintech is a Recombinant antibody targeting FHL2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86060-1-RR targets FHL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, PANC-1 cells, U2OS cells, hTERT-RPE1 cells, MG-63 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information FHL2(Four and a half LIM domains protein 2), also known as DRAL. It is located in cytoplasm and nucleus. The protein is expressed in skeletal muscle and heart. May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation. Negatively regulates the calcineurin/NFAT signaling pathway in cardiomyocytes (PMID: 28717008). The molecular weight of FHL2 is 32 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29655 Product name: Recombinant human FHL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-279 aa of BC014397 Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI Predict reactive species Full Name: four and a half LIM domains 2 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC014397 Gene Symbol: FHL2 Gene ID (NCBI): 2274 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14192 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.