Iright
BRAND / VENDOR: Proteintech

Proteintech, 86065-1-RR, ZNF74 Recombinant monoclonal antibody

CATALOG NUMBER: 86065-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZNF74 (86065-1-RR) by Proteintech is a Recombinant antibody targeting ZNF74 in WB, ELISA applications with reactivity to human, mouse, rat samples 86065-1-RR targets ZNF74 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13580 Product name: Recombinant human ZNF74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 464-644 aa of BC013395 Sequence: RIHSGEKPFKCNECGKAFSSHAYLIVHRRIHTGEKPFDCSQCWKAFSCHSSLIVHQRIHTGEKPYKCSECGRAFSQNHCLIKHQKIHSGEKSFKCEKCGEMFNWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPGSLLGAGDAGLRDVDPIDALDVAKLLCVVPPRAGRNFSLGSKPRN Predict reactive species Full Name: zinc finger protein 74 Calculated Molecular Weight: 644 aa, 72 kDa Observed Molecular Weight: 64-72 kDa GenBank Accession Number: BC013395 Gene Symbol: ZNF74 Gene ID (NCBI): 7625 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16587 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924