Proteintech, 86082-3-RR, Lumican Recombinant monoclonal antibody

Size: 20ul / 100ul The Lumican (86082-3-RR) by Proteintech is a Recombinant antibody targeting Lumican in WB, ELISA applications with reactivity to mouse samples 86082-3-RR targets Lumican in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Recombinant protein, mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information umican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa. Studies show that lumican participates in the maintenance of tissue homeostasis and modulates cellular functions including cell proliferation, migration, and differentiation. (PMID: 18949819; 22252641; 9761754; 22365843) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2481 Product name: Recombinant Mouse Lumican protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-338 aa of NM_008524.2 Sequence: QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN Predict reactive species Full Name: lumican Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 50-100 kDa GenBank Accession Number: NM_008524.2 Gene Symbol: Lum Gene ID (NCBI): 17022 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51885 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.