Proteintech, 86087-2-RR, MGLL Recombinant monoclonal antibody

Size: 20ul / 100ul The MGLL (86087-2-RR) by Proteintech is a Recombinant antibody targeting MGLL in WB, ELISA applications with reactivity to human samples 86087-2-RR targets MGLL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, human peripheral blood platelets, U-87 MG cells, SMMC-7721 cells, PC-3 cells, LNCaP cells Positive IF/ICC detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MGLL (monoglyceride lipase) is also named as MAGL, HU-K5 and belongs to the monoacylglycerol lipase family. It converts monoacylglycerides to free fatty acids and glycerol and functions together with hormone-sensitive lipase (HSL) in the mobilization of fatty acids from the triglyceride stores of adipocytes. MGL protein is ubiquitously expressed in kidney, spleen, heart, liver, stomach, brain, lung, adrenal gland, adipose tissue and in brain Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6970 Product name: Recombinant human MGLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC000551 Sequence: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP Predict reactive species Full Name: monoglyceride lipase Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC000551 Gene Symbol: MGLL Gene ID (NCBI): 11343 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A0A0C4DFN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.