Proteintech, 86089-1-RR, GPR17 Recombinant monoclonal antibody

Size: 20ul / 100ul The GPR17 (86089-1-RR) by Proteintech is a Recombinant antibody targeting GPR17 in WB, ELISA applications with reactivity to human, mouse, rat samples 86089-1-RR targets GPR17 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GPR17 is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes, particularly in the central nervous system (CNS). GPR17 is considered a modulator of CNS myelination and is involved in reconstructing and repairing demyelinating plaques caused by ongoing inflammatory processes, such as in multiple sclerosis (MS). It is present in nerve cells and precursor oligodendrocyte cells, playing a role in the differentiation and maturation of oligodendrocytes (PMID: 32182666). GPR17 is a multifaceted GPCR with implications in immune regulation, glucose metabolism, neurodegenerative diseases, and potentially in treating anxiety disorders. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4106 Product name: Recombinant human GPR17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC031653 Sequence: VPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL Predict reactive species Full Name: G protein-coupled receptor 17 Calculated Molecular Weight: 367 aa, 41 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC031653 Gene Symbol: GPR17 Gene ID (NCBI): 2840 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13304 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.