Proteintech, 86091-1-RR, CNOT8 Recombinant monoclonal antibody

Size: 20ul / 100ul The CNOT8 (86091-1-RR) by Proteintech is a Recombinant antibody targeting CNOT8 in WB, ELISA applications with reactivity to human, rat samples 86091-1-RR targets CNOT8 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HL-60 cells, U-251 cells, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CCR4-NOT transcription complex subunit 8(CNOT8), is a ubiquitous transcription factor, which required for a diverse set of processes. The CCR4-NOT complex is a global regulator of RNA polymerase II, and functions as general transcription regulation complex. It consisted part by CCR4, NOT1 to NOT5, and CAF1. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1201 Product name: Recombinant human CNOT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC017366 Sequence: MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ Predict reactive species Full Name: CCR4-NOT transcription complex, subunit 8 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC017366 Gene Symbol: CNOT8 Gene ID (NCBI): 9337 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UFF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.