Proteintech, 86099-1-RR, SNRPB Recombinant monoclonal antibody

Size: 20ul / 100ul The SNRPB (86099-1-RR) by Proteintech is a Recombinant antibody targeting SNRPB in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86099-1-RR targets SNRPB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, A549 cells, Jurkat cells, Ramos cells, K-562 cells, NIH/3T3 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1) is a core component of the spliceosome, a complex molecular machine that plays a critical role in pre-mRNA splicing. This process is essential for the removal of introns and the joining of exons to produce mature mRNA molecules. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10298 Product name: Recombinant human SNRPB protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-234 aa of BC003530 Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGKCLQW Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptides B and B1 Calculated Molecular Weight: 234aa,25 kDa; 285aa,30 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC003530 Gene Symbol: SNRPB Gene ID (NCBI): 6628 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P14678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.