Iright
BRAND / VENDOR: Proteintech

Proteintech, 86109-1-RR, IFT172 Recombinant monoclonal antibody

CATALOG NUMBER: 86109-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IFT172 (86109-1-RR) by Proteintech is a Recombinant antibody targeting IFT172 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86109-1-RR targets IFT172 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse ovary tissue Positive IF/ICC detected in: Starvation treated hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28921 Product name: Recombinant human IFT172 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1206-1408 aa of BC137126 Sequence: QARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREATKKGARGVEGFVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDS Predict reactive species Full Name: intraflagellar transport 172 homolog (Chlamydomonas) Calculated Molecular Weight: 1749 aa, 198 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC137126 Gene Symbol: IFT172 Gene ID (NCBI): 26160 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UG01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924