Iright
BRAND / VENDOR: Proteintech

Proteintech, 86131-1-RR, ADSL Recombinant monoclonal antibody

CATALOG NUMBER: 86131-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ADSL (86131-1-RR) by Proteintech is a Recombinant antibody targeting ADSL in WB, ELISA applications with reactivity to human, mouse, rat samples 86131-1-RR targets ADSL in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, Ramos cells, NIH/3T3 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Adenylosuccinate lyase (ADSL) is an essential enzyme for de novo purine biosynthesis and the purine nucleotide cycle, where it plays a key role in the regulation of adenosine monophosphate levels in the cells. Given its crucial role in both cellular replication and metabolism, it is not surprising that ADSL has been found dysregulated in several malignancies, including breast and endometrial cancers as well as glioma. (PMID: 33754045) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7332 Product name: Recombinant human ADSL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC000253 Sequence: MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNT Predict reactive species Full Name: adenylosuccinate lyase Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC000253 Gene Symbol: ADSL Gene ID (NCBI): 158 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30566 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924