Proteintech, 86131-2-RR, ADSL Recombinant monoclonal antibody

Size: 20ul / 100ul The ADSL (86131-2-RR) by Proteintech is a Recombinant antibody targeting ADSL in WB, ELISA applications with reactivity to human, mouse, rat samples 86131-2-RR targets ADSL in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, HL-60 cells, Ramos cells, NIH/3T3 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ADSL(adenylosuccinate lyase) is also named as AMPS, ASase, ASL and belongs to the lyase 1 family. It is an enzyme involved in 2 pathways of purine nucleotide metabolism and catalyzes cleavage of succinyl groups to yield fumarate (PMID:18524658). Defects in ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency). In humans, mutations in ADSL lead to an inborn error of metabolism originally characterized by developmental delay, often with autistic features (PMID:20884265). The ADSL enzymatic activity is reduced in lymphocytes and red blood cells of the patient with severe psychomotor retardation (PMID:9545543). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7332 Product name: Recombinant human ADSL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC000253 Sequence: MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNT Predict reactive species Full Name: adenylosuccinate lyase Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC000253 Gene Symbol: ADSL Gene ID (NCBI): 158 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30566 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.