Iright
BRAND / VENDOR: Proteintech

Proteintech, 86140-1-RR, REL Recombinant monoclonal antibody

CATALOG NUMBER: 86140-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The REL (86140-1-RR) by Proteintech is a Recombinant antibody targeting REL in WB, ELISA applications with reactivity to human samples 86140-1-RR targets REL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, MOLT-4 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information REL, also known as, Proto-oncogene c-Rel, is a 619 amino acid protein, which may play a role in differentiation and lymphopoiesis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26803 Product name: Recombinant human REL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-471 aa of NM_001291746 Sequence: MYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVG Predict reactive species Full Name: v-rel reticuloendotheliosis viral oncogene homolog (avian) Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 68-78 kDa GenBank Accession Number: NM_001291746 Gene Symbol: REL Gene ID (NCBI): 5966 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04864 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924