Iright
BRAND / VENDOR: Proteintech

Proteintech, 86168-1-RR, BMP4 Recombinant monoclonal antibody

CATALOG NUMBER: 86168-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BMP4 (86168-1-RR) by Proteintech is a Recombinant antibody targeting BMP4 in WB, ELISA applications with reactivity to human, mouse, rat samples 86168-1-RR targets BMP4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HT-29 cells, U2OS cells, mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information BMP4, also named as BMP2B and DVR4, belongs to the TGF-beta family. BMPs have been shown to promote astroglial differentiation both in vitro and in vivo. BMP4 have been shown to be components of serum and are thought to be responsible for this differentiation. BMP4 are expressed mainly in neurons, with minimal expression detected in astrocytes and oligodendrocytes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3191 Product name: Recombinant human BMP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-408 aa of BC020546 Sequence: ASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEAISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR Predict reactive species Full Name: bone morphogenetic protein 4 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC020546 Gene Symbol: BMP4 Gene ID (NCBI): 652 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12644 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924