Proteintech, 86177-2-RR, CDK5RAP3 Recombinant monoclonal antibody

Size: 20ul / 100ul The CDK5RAP3 (86177-2-RR) by Proteintech is a Recombinant antibody targeting CDK5RAP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 86177-2-RR targets CDK5RAP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A431 cells, HEK-293T cells, Jurkat cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cyclin-dependent kinase 5 (CDK5) regulatory subunit associated protein 3 (CDK5RAP3, also named as C53 or LZAP) was initially identified as a binding protein of CDK5 activator p35. CDK5RAP3 is widely expressed in human tissues and broadly located in subcellular compartments. By interacting with other proteins, CDK5RAP3 participates in the regulation of multiple cellular processes including cell cycle, apoptosis, cell invasion, signaling transduction, autophagy, UFMylation and endoplasmic reticulum (ER) stress. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1474 Product name: Recombinant human CDK5RAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC009957 Sequence: MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES Predict reactive species Full Name: CDK5 regulatory subunit associated protein 3 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC009957 Gene Symbol: CDK5RAP3 Gene ID (NCBI): 80279 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96JB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.