Iright
BRAND / VENDOR: Proteintech

Proteintech, 86205-2-RR, RPL13 Recombinant monoclonal antibody

CATALOG NUMBER: 86205-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RPL13 (86205-2-RR) by Proteintech is a Recombinant antibody targeting RPL13 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, monkey samples 86205-2-RR targets RPL13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, MCF-7 cells, COS-7 cells, SGC-7091 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information The mammalian ribosome comprises 79 ribosomal proteins and four rRNAs, which combine in equimolar ratios to form the small (40S) and large (60S) subunits. Ribosome proteins are a direct and critical target of the PI3K pathway in promoting growth.[PMID:15289434]. RPL13 may be a plausible candidate tumor suppressor gene, as knocking down L13 expression using small interfering RNA (siRNA) resulted in drastic attenuation of cancer cell growth with significant G1 and G2/M arrest of the cell cycle[PMID:16786168]. Specification Tested Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1814 Product name: Recombinant human RPL13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC014167 Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA Predict reactive species Full Name: ribosomal protein L13 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC014167 Gene Symbol: RPL13 Gene ID (NCBI): 6137 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26373 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924