Iright
BRAND / VENDOR: Proteintech

Proteintech, 86214-1-RR, SCF Recombinant monoclonal antibody

CATALOG NUMBER: 86214-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SCF (86214-1-RR) by Proteintech is a Recombinant antibody targeting SCF in WB, ELISA applications with reactivity to mouse, rat samples 86214-1-RR targets SCF in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, Recombinant protein, PC-12 cells, mouse bone marrow tissue, mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Stem cell factor (SCF) is also named as mast cell growth factor (MGF), Kit ligand (Kitl), c-Kit ligand, steel factor and Kitlg. SCF is a pleiotropic cytokine (also as a dimeric molecule) that mediates regulatory effects on inflammation, tissue remodeling, and fibrosis through binding to and activating its receptor tyrosine kinase c-Kit (PMID: 1698553, PMID: 8630386, PMID: 23073628). SCF is the ligand of c-Kit, a member of the RTKs family. Molecular activity of RTKs is a primary stimulus of cell motility, and expression of the SCF/c-Kit axis is associated with cell migration (PMID: 28629522). SCF is a cytokine that synergizes the effects of Epo during erythropoiesis. Stem cell factor plays a well-described role in regulating the survival, proliferation, migration, and differentiation of hematopoietic progenitors, melanocytes, and germ cells (PMID: 36688460). More recent studies have demonstrated SCF expression in dermal and intestinal epithelial cells, and increased SCF expression has been reported in the inflamed mucosa of individuals with IBD and colonitis (PMID: 18200049, PMID: 30157426). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0402 Product name: Recombinant Mouse SCF protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-189 aa of NM_013598 Sequence: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA Predict reactive species Full Name: kit ligand Calculated Molecular Weight: 31KD Observed Molecular Weight: 31 kDa GenBank Accession Number: NM_013598 Gene Symbol: Kitl Gene ID (NCBI): 17311 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20826-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924