Iright
BRAND / VENDOR: Proteintech

Proteintech, 86217-1-RR, PRPS1 Recombinant monoclonal antibody

CATALOG NUMBER: 86217-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PRPS1 (86217-1-RR) by Proteintech is a Recombinant antibody targeting PRPS1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86217-1-RR targets PRPS1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, U-87 MG cells, mouse kidney tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PRPS1, also named as Ribose-phosphate pyrophosphokinase 1, is a 318 amino acid protein, which belongs to the ribose-phosphate pyrophosphokinase family. PRPS1 can form Homodimer and the active form is probably a hexamer composed of 3 homodimers. PRPS1 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) which is essential for nucleotide synthesis. PRPS1 as a module has an association with the Hepatocellular carcinoma. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7907 Product name: Recombinant human PRPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-318 aa of BC001605 Sequence: MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL Predict reactive species Full Name: phosphoribosyl pyrophosphate synthetase 1 Calculated Molecular Weight: 318 aa, 35 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC001605 Gene Symbol: PRPS1 Gene ID (NCBI): 5631 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P60891 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924