Proteintech, 86227-4-RR, CUGBP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CUGBP1 (86227-4-RR) by Proteintech is a Recombinant antibody targeting CUGBP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 86227-4-RR targets CUGBP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, SH-SY5Y cells, HL-60, NIH/3T3 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information CUG triplet repeat RNA binding protein 1 (CUGBP1) is a member of the CUGBP Elav-like family (CELF), which plays an important role in cardiac development and function (PMID: 17130239). CUGBP1 has also been shown to localize to cytoplasmic stress granules when cells are stressed. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3677 Product name: Recombinant human CUGBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 107-479 aa of BC031079 Sequence: DRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKND Predict reactive species Full Name: CUG triplet repeat, RNA binding protein 1 Calculated Molecular Weight: 483 aa, 52 kDa Observed Molecular Weight: 51-55 kDa GenBank Accession Number: BC031079 Gene Symbol: CUGBP1 Gene ID (NCBI): 10658 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.