Proteintech, 86263-1-RR, CD81 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD81 (86263-1-RR) by Proteintech is a Recombinant antibody targeting CD81 in WB, IHC, ELISA applications with reactivity to mouse samples 86263-1-RR targets CD81 in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3833 Product name: Recombinant Mouse CD81 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 106-211 aa of NM_133655.2 Sequence: VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV Predict reactive species Full Name: CD81 antigen Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: NM_133655.2 Gene Symbol: Cd81 Gene ID (NCBI): 12520 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35762 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.