Proteintech, 86266-1-RR, C19orf59 Recombinant monoclonal antibody

Size: 20ul / 100ul The C19orf59 (86266-1-RR) by Proteintech is a Recombinant antibody targeting C19orf59 in WB, IF/ICC, ELISA applications with reactivity to human samples 86266-1-RR targets C19orf59 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information The MCEMP1 gene contains seven exons and was mapped to human chromosome 19p13.3. The epitope-tagged MCEMP1 has been expressed in mammalian cells and found to be localized to the cellular membrane with its C-terminus extending to the outside of the membrane and N-terminus into the cytoplasmic compartment. An evidently increased expression of mast cell expression membrane protein 1 (MCEMP1) has been observed in stroke patients and its expression independently improved the discrimination of 1-month outcome, suggesting the functionality of peripheral blood expression of MCEMP1 as a biomarker for stroke prognosis . (PMID: 30883005, PMID: 31104315, PMID: 15953541) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22616 Product name: Recombinant human C19orf59 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC104798 Sequence: MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ Predict reactive species Full Name: chromosome 19 open reading frame 59 Observed Molecular Weight: 22/24 kDa GenBank Accession Number: BC104798 Gene Symbol: MCEMP1 Gene ID (NCBI): 199675 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IX19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.