Proteintech, 86274-1-RR, MCU/CCDC109A Recombinant monoclonal antibody

Size: 20ul / 100ul The MCU/CCDC109A (86274-1-RR) by Proteintech is a Recombinant antibody targeting MCU/CCDC109A in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86274-1-RR targets MCU/CCDC109A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, PANC-1 cells, A549 cells, NIH/3T3 cells, mouse skeletal muscle tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information MCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24733 Product name: Recombinant human CCDC109A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 155-233 aa of BC034235 Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT Predict reactive species Full Name: coiled-coil domain containing 109A Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC034235 Gene Symbol: CCDC109A Gene ID (NCBI): 90550 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NE86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.