Iright
BRAND / VENDOR: Proteintech

Proteintech, 86278-1-RR, UBE2T/HSPC150 Recombinant monoclonal antibody

CATALOG NUMBER: 86278-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The UBE2T/HSPC150 (86278-1-RR) by Proteintech is a Recombinant antibody targeting UBE2T/HSPC150 in WB, IHC, ELISA applications with reactivity to human samples 86278-1-RR targets UBE2T/HSPC150 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, SKOV-3 cells, Jurkat cells, K-562 cells, SW480 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information uitin (Ub)-mediated protein degradation pathway involves three sequential enzymatic steps that facilitate the conjugation of Ub to specific protein substrates. The first step requires ATP-dependent activation of the C-terminus of Ub and the assembly of multi-Ubs by Ub-activating enzyme E1. The ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain, is then conjugated to Ubs, through a thiol-ester linkage between a conserved cysteine and the C-terminus of Ub, to generate an intermediate Ub-E2 complex. Then the E3, a ligase, catalyzes the transfer of Ub from E2 to the appropriate substrate. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins), which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0153 Product name: Recombinant human UBE2T protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-190 aa of BC004152 Sequence: QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIE Predict reactive species Full Name: ubiquitin-conjugating enzyme E2T (putative) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC004152 Gene Symbol: UBE2T Gene ID (NCBI): 29089 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NPD8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924