Iright
BRAND / VENDOR: Proteintech

Proteintech, 86299-3-RR, L-Plastin Recombinant monoclonal antibody

CATALOG NUMBER: 86299-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The L-Plastin (86299-3-RR) by Proteintech is a Recombinant antibody targeting L-Plastin in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86299-3-RR targets L-Plastin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, Ramos cells, Jurkat cells, mouse spleen tissue Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LCP1, also known as L-Plastin, is a member of the Plastin gene family. The family members include L-Plastin (LCP1), T-Plastin (PLS3), and I-Plastin (PLS1), which can regulate the dynamic reorganization of the cytoskeleton by binding and cross-linking actin filaments. In lymphocytes, LCP1 can regulate immune responses, especially during inflammation and infection. It acts as a key regulator of T-cell activation by responding to co-stimulatory signals through TCR/CD3 and CD2 or CD28, and regulates the cell-surface expression of IL2RA/CD25 and CD69 (PMID: 17294403). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3571 Product name: Recombinant human LCP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-627 aa of BC010271 Sequence: LENAGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAEKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV Predict reactive species Full Name: lymphocyte cytosolic protein 1 (L-plastin) Calculated Molecular Weight: 627 aa, 64 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC010271 Gene Symbol: L-Plastin Gene ID (NCBI): 3936 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924