Iright
BRAND / VENDOR: Proteintech

Proteintech, 86312-1-RR, PPIL1 Recombinant monoclonal antibody

CATALOG NUMBER: 86312-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PPIL1 (86312-1-RR) by Proteintech is a Recombinant antibody targeting PPIL1 in WB, ELISA applications with reactivity to human samples 86312-1-RR targets PPIL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A375 cells, K-562 cells, human heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Peptidyl-prolyl isomerase (PPIase) catalyzes the interconversion of a specific Pro-imide bond between the cis and trans conformations. PPIL1 (Peptidyl-prolyl cis-trans isomerase-like 1) is up-regulated in human colon cancer cells and an siRNA-mediated knockdown of PPIL1 resulted in a reduced number of viable cell (PMID: 20368803). Expression of PPIL1 was shown to be ubiquitous across all adult tissues (with highest expression in the adrenal gland, testis and heart). PPIL1 is also known to participate in the spliceosome; a complex and dynamic protein and RNA complex responsible for splicing introns from pre-mRNA (PMID: 33220177, 8978786). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7436 Product name: Recombinant human PPIL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC003048 Sequence: MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Predict reactive species Full Name: peptidylprolyl isomerase (cyclophilin)-like 1 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC003048 Gene Symbol: PPIL1 Gene ID (NCBI): 51645 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y3C6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924