Proteintech, 86335-3-RR, SNX1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SNX1 (86335-3-RR) by Proteintech is a Recombinant antibody targeting SNX1 in WB, ELISA applications with reactivity to human samples 86335-3-RR targets SNX1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293T cells, HeLa cells, HepG2 cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Sorting nexin 1 (SNX1, synonyms: SNX1A, MGC8664, HsT17379) is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. SNX1 also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0499 Product name: Recombinant human SNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-287 aa of BC000357 Sequence: DQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM Predict reactive species Full Name: sorting nexin 1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC000357 Gene Symbol: SNX1 Gene ID (NCBI): 6642 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13596 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.