Iright
BRAND / VENDOR: Proteintech

Proteintech, 86344-3-RR, DAZL Recombinant monoclonal antibody

CATALOG NUMBER: 86344-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DAZL (86344-3-RR) by Proteintech is a Recombinant antibody targeting DAZL in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 86344-3-RR targets DAZL in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:1000-1:4000 Background Information DAZL proteins are germ cell-specific RNA-binding proteins and are considered major regulators of spermatogenesis. Because DAZL is a novel protein expressed specifically in germ cells, it is widely employed as a germ cell marker. In humans, immunostaining shows DAZL is abundant in the cytoplasm of primary spermatocytes, but scarce in spermatogonia. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag37074 Product name: Recombinant human DAZL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-295 aa of BC027595 Sequence: QRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV Predict reactive species Full Name: deleted in azoospermia-like Calculated Molecular Weight: 295 aa, 33 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC027595 Gene Symbol: DAZL Gene ID (NCBI): 1618 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92904 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924