Iright
BRAND / VENDOR: Proteintech

Proteintech, 86351-1-RR, WBSCR17 Recombinant monoclonal antibody

CATALOG NUMBER: 86351-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The WBSCR17 (86351-1-RR) by Proteintech is a Recombinant antibody targeting WBSCR17 in WB, ELISA applications with reactivity to human, mouse, rat samples 86351-1-RR targets WBSCR17 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information WBSCR17, also known as GALNT17, which encodes a brain-expressed N-acetylgalactosaminyl transferase (GalNAcT), is located at the distal edge of a region that is commonly deleted or duplicated in Williams Beuren Syndrome (WBS), a developmental disorder with motor and coordination problems, impaired visuospatial memory, and abnormal social interaction (PMID: 31554716). WBSCR17 loss-of-function has significant effects on cerebellar development, and is associated with phenotypes including developmental delay, deficits in motor coordination, reduced exploratory activity, and impaired social behavior (PMID: 22787146). With the calculated molecular mass of recombinant WBSCR17 being 68 kDa, the 70-90-kDa glycoproteins could also be detected due to post-translational modifications (PMID: 22787146). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15792 Product name: Recombinant human WBSCR17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC069624 Sequence: MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE Predict reactive species Full Name: Williams-Beuren syndrome chromosome region 17 Calculated Molecular Weight: 598 aa, 68 kDa Observed Molecular Weight: 70~90 kDa GenBank Accession Number: BC069624 Gene Symbol: WBSCR17 Gene ID (NCBI): 64409 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6IS24 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924