Proteintech, 86362-2-RR, HLTF Recombinant monoclonal antibody

Size: 20ul / 100ul The HLTF (86362-2-RR) by Proteintech is a Recombinant antibody targeting HLTF in WB, ELISA applications with reactivity to human, mouse, monkey samples 86362-2-RR targets HLTF in WB, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: U-937 cells, HeLa cells, K-562 cells, HCT 116 cells, COS-7 cells, NIH//3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Helicase-like Transcription Factor (HLTF) is a crucial nuclear protein and member of the SWI/SNF family of chromatin-remodeling complexes, playing a dual role in transcription regulation and DNA damage repair. It functions dually as a regulator of gene expression, utilizing its ATP-dependent helicase activity to modify chromatin structure and facilitate transcription, and as a central effector in the DNA damage response pathway. HLTF is particularly crucial for promoting error-free DNA repair at stalled replication forks via a mechanism called template switching, which prevents the accumulation of mutagenic lesions. HLTF can be detected as 114 kDa. Specification Tested Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5596 Product name: Recombinant human HLTF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC044659 Sequence: MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKADGLS Predict reactive species Full Name: helicase-like transcription factor Calculated Molecular Weight: 114 kDa Observed Molecular Weight: 114 kDa GenBank Accession Number: BC044659 Gene Symbol: HLTF Gene ID (NCBI): 6596 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14527 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.