Iright
BRAND / VENDOR: Proteintech

Proteintech, 86369-1-RR, GALM Recombinant monoclonal antibody

CATALOG NUMBER: 86369-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GALM (86369-1-RR) by Proteintech is a Recombinant antibody targeting GALM in WB, ELISA applications with reactivity to human, mouse, rat samples 86369-1-RR targets GALM in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, SK-N-SH cells, SH-SY5Y cells, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information GALM, also named as Aldose 1-epimerase, belongs to the aldose epimerase family. GALM is a mutarotase that catalyzes the interconversion of beta-D-galactose and alpha-D-galactose during galactose metabolism. GALM is involved in the maintenance of the equilibrium between the beta- and alpha-anomers of galactose, therefore ensuring a sufficient supply of the alpha-anomer for GALK1. GALM is also active on D-glucose, but its preference for galactose is higher than that of glucose. The calculated molecular weight of GALM is 38 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8842 Product name: Recombinant human GALM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-342 aa of BC019263 Sequence: MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA Predict reactive species Full Name: galactose mutarotase (aldose 1-epimerase) Calculated Molecular Weight: 342 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC019263 Gene Symbol: GALM Gene ID (NCBI): 130589 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96C23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924