Iright
BRAND / VENDOR: Proteintech

Proteintech, 86372-1-RR, BHMT Recombinant monoclonal antibody

CATALOG NUMBER: 86372-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BHMT (86372-1-RR) by Proteintech is a Recombinant antibody targeting BHMT in WB, IP, ELISA applications with reactivity to human, rat samples 86372-1-RR targets BHMT in WB, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat liver tissue, human kidney tissue Positive IP detected in: rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Betaine-homocysteine methyltransferase (BHMT) is a cytosolic enzyme that Involved in the regulation of homocysteine metabolism. BHMT catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline(PMID: 8798461, 10529246). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8738 Product name: Recombinant human BHMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-406 aa of BC012616 Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ Predict reactive species Full Name: betaine-homocysteine methyltransferase Calculated Molecular Weight: 406 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC012616 Gene Symbol: BHMT Gene ID (NCBI): 635 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q93088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924