Proteintech, 86384-3-RR, PR3/PRTN3 Recombinant monoclonal antibody

Size: 20ul / 100ul The PR3/PRTN3 (86384-3-RR) by Proteintech is a Recombinant antibody targeting PR3/PRTN3 in WB, ELISA applications with reactivity to mouse, rat samples 86384-3-RR targets PR3/PRTN3 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2750 Product name: recombinant mouse Prtn3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 28-250 aa of NM_011178.2 Sequence: SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWIQNVLR Predict reactive species Full Name: proteinase 3 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: NM_011178.2 Gene Symbol: Prtn3 Gene ID (NCBI): 19152 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61096 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.