Iright
BRAND / VENDOR: Proteintech

Proteintech, 86430-1-RR, ZMYND10 Recombinant monoclonal antibody

CATALOG NUMBER: 86430-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZMYND10 (86430-1-RR) by Proteintech is a Recombinant antibody targeting ZMYND10 in WB, ELISA applications with reactivity to human, mouse, rat samples 86430-1-RR targets ZMYND10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse kidney tissue, rat kidney tissue, rat testis tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ZMYND10 (Zinc finger MYND domain-containing protein 10), also known as BLU, encodes a 50-kDa protein containing an MYND-type zinc finger DNA-binding domain in the C-terminus that is commonly found in transcription repressors. ZMYND10 is highly enriched in ciliated cells compared with that in nonciliated cells and is expressed in motile ciliated tissues in mice (PMID: 23891471). ZMYND10 is a tumor suppressor that can induce apoptosis, arrest cell cycle, and inhibit proliferation and angiogenesis in different tumors (PMID: 29601588, 31801619). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5808 Product name: Recombinant human ZMYND10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-440 aa of BC033732 Sequence: MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK Predict reactive species Full Name: zinc finger, MYND-type containing 10 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC033732 Gene Symbol: ZMYND10 Gene ID (NCBI): 51364 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75800 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924