Proteintech, 86455-1-RR, CTP synthase Recombinant monoclonal antibody

Size: 20ul / 100ul The CTP synthase (86455-1-RR) by Proteintech is a Recombinant antibody targeting CTP synthase in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86455-1-RR targets CTP synthase in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, K-562 cells, Raji cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CTP synthase (CTPS) is a ubiquitous, cytosolic glutamine amidotransferase that catalyzes the ATP-dependent conversion of uridine-5′-triphosphate (UTP) to cytidine-5′-triphosphate (CTP) - the final, rate-limiting step in the de novo pyrimidine biosynthetic pathway. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8707 Product name: Recombinant human CTPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-591 aa of BC009408 Sequence: ICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRIGSSSPDSEITELKFPSINHD Predict reactive species Full Name: CTP synthase Calculated Molecular Weight: 591 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC009408 Gene Symbol: CTPS Gene ID (NCBI): 1503 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17812 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.