Iright
BRAND / VENDOR: Proteintech

Proteintech, 86464-1-RR, WDR24 Recombinant monoclonal antibody

CATALOG NUMBER: 86464-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The WDR24 (86464-1-RR) by Proteintech is a Recombinant antibody targeting WDR24 in WB, ELISA applications with reactivity to human samples 86464-1-RR targets WDR24 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, HuH-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information WDR24 is a component of the GATOR2 complex which has five known subunits (WDR24, WDR59, Mios, Sec13, and Seh1L). GATOR2 complex positively regulates mTORC1 signaling by acting upstream of or in parallel to GATOR1, which is a GTPase-activating protein (GAP) for RagA or RagB and an inhibitor of the amino-acid-sensing pathway. (PMID: 23723238; 25263562) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14774 Product name: Recombinant human WDR24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 440-790 aa of BC008025 Sequence: LGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS Predict reactive species Full Name: WD repeat domain 24 Calculated Molecular Weight: 920 aa, 102 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC008025 Gene Symbol: WDR24 Gene ID (NCBI): 84219 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96S15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924