Product Description
Size: 20ul / 100ul
The CCL17/TARC (86482-1-RR) by Proteintech is a Recombinant antibody targeting CCL17/TARC in WB, ELISA applications with reactivity to mouse samples
86482-1-RR targets CCL17/TARC in WB, ELISA applications and shows reactivity with mouse samples.
Tested Applications
Positive WB detected in: NR8383 cells, MH-S cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
CCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4.
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg3319 Product name: recombinant mouse Ccl17 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-93 aa of NM_011332.3 Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP Predict reactive species
Full Name: chemokine (C-C motif) ligand 17
Calculated Molecular Weight: 11 kDa
Observed Molecular Weight: 11 kDa
GenBank Accession Number: NM_011332.3
Gene Symbol: Ccl17
Gene ID (NCBI): 20295
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: F6R5P4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924