Proteintech, 86482-1-RR, CCL17/TARC Recombinant monoclonal antibody

Size: 20ul / 100ul The CCL17/TARC (86482-1-RR) by Proteintech is a Recombinant antibody targeting CCL17/TARC in WB, ELISA applications with reactivity to mouse samples 86482-1-RR targets CCL17/TARC in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: NR8383 cells, MH-S cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3319 Product name: recombinant mouse Ccl17 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-93 aa of NM_011332.3 Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP Predict reactive species Full Name: chemokine (C-C motif) ligand 17 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_011332.3 Gene Symbol: Ccl17 Gene ID (NCBI): 20295 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: F6R5P4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.