Product Description
Size: 20ul / 100ul
The LOXL1 (86534-1-RR) by Proteintech is a Recombinant antibody targeting LOXL1 in WB, ELISA applications with reactivity to human samples
86534-1-RR targets LOXL1 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF-7 cells, MG-63 cells, PC-3 cells, U-87 MG cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag24293 Product name: Recombinant human LOXL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-366 aa of BC015090 Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG Predict reactive species
Full Name: lysyl oxidase-like 1
Calculated Molecular Weight: 63 kDa
Observed Molecular Weight: 60-63 kDa
GenBank Accession Number: BC015090
Gene Symbol: LOXL1
Gene ID (NCBI): 4016
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q08397
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924