Proteintech, 86545-3-RR, CCL6/C10 Recombinant monoclonal antibody

Size: 20ul / 100ul The CCL6/C10 (86545-3-RR) by Proteintech is a Recombinant antibody targeting CCL6/C10 in WB, IF/ICC, ELISA applications with reactivity to mouse samples 86545-3-RR targets CCL6/C10 in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Transfected with Mouse Ccl6 HEK-293T cells Positive IF/ICC detected in: Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CCL6, formerly known as C10 or MRP-1 (Macrophage Inflammatory Protein-Related Protein-1), is a small secretory protein belonging to the CC chemokine family. Chemokines are a large family of cytokines, or signaling proteins, renowned for their ability to induce directed migration (chemotaxis) of nearby responsive cells. CCL6 is a crucial CC chemokine in mice that acts primarily through the CCR1 receptor to orchestrate the migration and activation of key immune cells. It is a central mediator in inflammation, host defense, and pathological processes like cancer and fibrosis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2957 Product name: Recombinant Mouse CCL6 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-116 aa of NM_009139.3 Sequence: GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA Predict reactive species Full Name: chemokine (C-C motif) ligand 6 Calculated Molecular Weight: 13 kDa GenBank Accession Number: NM_009139.3 Gene Symbol: Ccl6 Gene ID (NCBI): 20305 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P27784 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.