Iright
BRAND / VENDOR: Proteintech

Proteintech, 86564-1-RR, CXCL13/BCA1 Recombinant monoclonal antibody

CATALOG NUMBER: 86564-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CXCL13/BCA1 (86564-1-RR) by Proteintech is a Recombinant antibody targeting CXCL13/BCA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse samples 86564-1-RR targets CXCL13/BCA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Transfected with Mouse Cxcl13 Transfected HEK-293T cells, Recombinant protein Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CXCL13 (C-X-C motif chemokine 13), originally named B-lymphocyte chemoattractant (BLC) or B cell-attracting chemokine 1 (BCA-1), is a homeostatic chemokine that is constitutively secreted by stromal cells in the B-cell follicles of secondary lymphoid tissues (e.g., spleen, lymph nodes, tonsils, and Peyer's patches). It plays a crucial role in orchestrating cell migration within distinct regions of secondary lymphoid organs, strongly attracting B lymphocytes (and, to a lesser extent, T cells and macrophages) via its receptor CXCR5 (originally named Burkitt's lymphoma receptor 1, BLR1). In addition to maintaining immune cell trafficking and lymphoid follicle development, CXCL13 is implicated in inflammatory and autoimmune diseases (e.g., systemic lupus erythematosus, rheumatoid arthritis) and tumor progression (e.g., multiple myeloma). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3331 Product name: Recombinant Mouse Cxcl13 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-109 aa of NM_018866 Sequence: ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA Predict reactive species Full Name: chemokine (C-X-C motif) ligand 13 Calculated Molecular Weight: 12 kDa GenBank Accession Number: NM_018866 Gene Symbol: Cxcl13 Gene ID (NCBI): 55985 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O55038 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924