Proteintech, 86577-1-RR, Pon3 Recombinant monoclonal antibody

Size: 20ul / 100ul The Pon3 (86577-1-RR) by Proteintech is a Recombinant antibody targeting Pon3 in WB, ELISA applications with reactivity to mouse, rat samples 86577-1-RR targets Pon3 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PON3 (paraoxonase 3) is a member of the paraoxonase gene family and shares high homology with PON1 and PON2. The PON3 protein is primarily synthesized by the liver and can bind to high-density lipoprotein (HDL), where it exerts antioxidant functions. PON3 can prevent the oxidation of low-density lipoprotein (LDL) and disrupt bacterial quorum-sensing molecules. Additionally, PON3 is expressed in mouse models of Alzheimer's disease (AD), with positive staining for PON3 detected in astrocytes surrounding Aβ plaques. These findings suggest that PON3 plays an important role in antioxidant stress and lipid peroxidation and may have potential protective effects on pathological processes such as neurodegenerative diseases and atherosclerosis. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2743 Product name: Recombinant Mouse Pon3 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-354 aa of NM_173006.1 Sequence: RLLNFRERVSTTREIKATEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPAFAPDKPGRIFLMDLNEQNPEAQALEISGGLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRMLIGTIFHKALYCDL Predict reactive species Full Name: paraoxonase 3 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_173006.1 Gene Symbol: Pon3 Gene ID (NCBI): 269823 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q62087 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.