Iright
BRAND / VENDOR: Proteintech

Proteintech, 86580-1-RR, Syntaxin 8 Recombinant monoclonal antibody

CATALOG NUMBER: 86580-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Syntaxin 8 (86580-1-RR) by Proteintech is a Recombinant antibody targeting Syntaxin 8 in WB, ELISA applications with reactivity to human, mouse, rat samples 86580-1-RR targets Syntaxin 8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue, fetal human brain tissue, human placenta tissue, mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Syntaxin 8 (STX8), also known as CIP-1-associated regulator of cyclin B (CARB ), is a protein belonging to the syntaxin family. The gene of STX8 maps to chromosomal band 17p12 and it encodes a 236-amino-acid protein containing 1 t-SNARE coiled-coil homology domain. STX8 mRNA is broadly expressed in multiple human tissues, including the heart, brain, kidney, liver, lung, placenta, skeletal muscle, spleen, and pancreas (PMID: 10198254). STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2850 Product name: Recombinant human STX8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC009713 Sequence: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKS Predict reactive species Full Name: syntaxin 8 Calculated Molecular Weight: 236 aa, 27 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC009713 Gene Symbol: Syntaxin 8 Gene ID (NCBI): 9482 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UNK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924