Iright
BRAND / VENDOR: Proteintech

Proteintech, 86602-3-RR, TAX1BP1 Recombinant monoclonal antibody

CATALOG NUMBER: 86602-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TAX1BP1 (86602-3-RR) by Proteintech is a Recombinant antibody targeting TAX1BP1 in WB, ELISA applications with reactivity to human samples 86602-3-RR targets TAX1BP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, A549 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TAX1BP1 (also named as T6BP and TXBP151) inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. It is degraded by caspase-3-like family proteins upon TNF-induced apoptosis. TAX1BP1 may also play a role in the pro-inflammatory cytokine IL-1 signaling cascade. TAX1BP1 binds TRAF6 but not TRAFs 1-5. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5789 Product name: Recombinant human TAX1BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 454-789 aa of BC050358 Sequence: KECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD Predict reactive species Full Name: Tax1 (human T-cell leukemia virus type I) binding protein 1 Calculated Molecular Weight: 91 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC050358 Gene Symbol: TAX1BP1 Gene ID (NCBI): 8887 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86VP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924